PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG033994t1
Common NameTCM_033994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family BES1
Protein Properties Length: 312aa    MW: 33935.1 Da    PI: 9.0346
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG033994t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.91.7e-65121473142
            DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                        +rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrkg+kp+   ++ gssa+++p ss++
  Thecc1EG033994t1  12 PRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKGCKPP-PIDIPGSSAKITPFSSQN 103
                       58************************************************************************.****************** PP

            DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsv 142
                        s+ ssa++sp++s + sp+sssfpsp++ld ++    +sllp+l+ 
  Thecc1EG033994t1 104 PSPLSSAFPSPIPSCQVSPSSSSFPSPTRLDANNP---SSLLPFLRS 147
                       *******************************9966...467777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-6113135IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MTSDGATSTP APRRKPSWRE RENNRRRERR RRAIAAKIYT GLRAQGNYNL PKHCDNNEVL  60
KALCAEAGWV VEEDGTTYRK GCKPPPIDIP GSSAKITPFS SQNPSPLSSA FPSPIPSCQV  120
SPSSSSFPSP TRLDANNPSS LLPFLRSAIP SSLPPLRISN SAPVTPPLSS PTSRNPKPIP  180
NWEAIAKESM ASFNYPFYAV SAPASPTHRH FHAPATIPEC DESDTSTVES GQWISFQKFA  240
PSTSQMPTSP TFNLVKPVVP QSLPNDLIME KGRGSEFQFE SGQVKPWEGE RIHEVGLDDL  300
ELTLGSGKAR C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11231RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017466.10.0Brassinosteroid signaling positive regulator family protein
SwissprotQ8S3071e-145BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A061FCF50.0A0A061FCF5_THECC; Brassinosteroid signaling positive regulator family protein
STRINGPOPTR_0014s04110.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-140BES1 family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]